Who knows how to extract sequences by gene numbers?

Source: Internet
Author: User
Who knows how to extract the sequence of gene numbers-Linux general technology-Linux technology and application information, the following is a detailed description. [I = s] This post was last edited by huangqp

Who knows how to use gene numbers to extract full sequences?
A file named file1 contains the following genetic code,
AT5G54820.1
AT5G32220.1
AT5G20470.1

The following is a database file file2, from which you want to extract the corresponding sequence from the following file using the gene number contained in the above file.

> AT5G54820.1 | Symbols: | scws protein | chr1: 19049283-19050416 FORWARD
QRDLAKDRPNASGLQEVLSHFKCLDIDNDPSCI
> AT5G20470.1 | Symbols: | ffdffs protein | chr1: 19049283-19050416 FORWARD
AINHLCICQANQASSVAWGVHAFSRKTQPLDN
> AT5G42150.1 | Symbols: | dwefs protein | chr1: 19049283-19050416 FORWARD
CCIADYEKGDKITCKFHDCIAENKCPMFHSSVR
> At44252570.1 | Symbols: | fghhfs protein | chr1: 19049283-19050416 FORWARD
CSICLQSLVSSSKTRMSHHNGLVELNRCPMFH
> AT5G32220.1 | Symbols: | shrb protein | chr1: 19049283-19050416 FORWARD
CSICMENLNSESSSENIISCLHLFHQSCIFESESS

Take the first sequence as an example to explain the so-called sequence, that is, the annotation + sequence.
Note:
> AT5G54820.1 | Symbols: | scws protein | chr1: 19049283-19050416 FORWARD
Sequence:
QRDLAKDRPNASGLQEVLSHFKCLDIDNDPSCI

In short, we want to use the AT5G54820.1 contained in file1 to propose its full sequence from file2, namely:

> AT5G54820.1 | Symbols: | scws protein | chr1: 19049283-19050416 FORWARD
QRDLAKDRPNASGLQEVLSHFKCLDIDNDPSCI

Of course, all the genetic numbers in file1 are available in file2!

You want to use common commands instead of program writing! Thank you !!!!!!!!!

Contact Us

The content source of this page is from Internet, which doesn't represent Alibaba Cloud's opinion; products and services mentioned on that page don't have any relationship with Alibaba Cloud. If the content of the page makes you feel confusing, please write us an email, we will handle the problem within 5 days after receiving your email.

If you find any instances of plagiarism from the community, please send an email to: info-contact@alibabacloud.com and provide relevant evidence. A staff member will contact you within 5 working days.

A Free Trial That Lets You Build Big!

Start building with 50+ products and up to 12 months usage for Elastic Compute Service

  • Sales Support

    1 on 1 presale consultation

  • After-Sales Support

    24/7 Technical Support 6 Free Tickets per Quarter Faster Response

  • Alibaba Cloud offers highly flexible support services tailored to meet your exact needs.