Install apache, php, and mysql on startos

After sudosu enters the password yget -- installapacheyget -- installphpyget -- installmysql is installed, enter localhost in the browser. does not respond to starting the service? How to start it? Find out where to install whereisapachewhereisphpwhereismysql ----------------------------- and enter

Sudo su enter password yget -- install apache yget -- install php yget -- install mysql are all installed, enter localhost in the browser, no response to start the service? How to start it? Find out where to install whereis apache whereis php whereis mysql ----------------------------- and enter

Sudo su

Enter Password

Yget -- install apache

Yget -- install php

Yget -- install mysql

All installed, enter localhost in the browser, no response

Want to start the service? How to start it?

First, find the installation path.

Whereis apache

Whereis php

Whereis mysql

-----------------------------

Enter the command: httpd-k start,

Cocould not reliably determine the server's fully qualified domain name, using 192.168.88.101 for ServerName

Check that it is a conf file problem.

Cd/etc/apache

Vim httpd. conf

Find # ServerName

Change to ServerName localhost: 80

Save, httpd-k start, succeeded

Sorry, it's not going to be continued...