Cloud Applications

Working Principle of sort command note 01sort: compare each line of the file as a unit and compare each other. the comparison principle is to compare the lines following the first character by ASCII code, finally, output the result in ascending

Currently, Ubuntu has become an important Server platform. users mainly use Ubuntu to execute general tasks such as websites, databases, archives, printing, and email servers, some users also use Ubuntu as a security, backup, and firewall... ubuntu

Batch scp script & mdash; copy files from multiple machines to conveniently retrieve logs from multiple servers, A simple script is written to copy server logs in batches to the machine where the script is executed. The script contains two files:

Bash-shell startup file Linux uses environment variables to identify itself in programs and scripts. This provides a simple way for your program to obtain system information. The question is how to set these variables. When you log on to the Linux

Tcpdump is a powerful protocol layer analysis tool in linux. it can be used to monitor network communication and locate network-related bugs. for example: whether a connection is created between the client and the server, the client sends a message,

SSH command line upload/download file upload: scp/path/file (local path) user (remote target user name) @ host (remote target IP address ): /pathorfile (file storage path) Download: scpuser (remote user name) @ host (remote IP):/path/file (download..

An error occurred while compiling pcremakemakepcre solve the problem. libtool: compile: unrecognizedoption '-DHAVE_CONFIG_H & amp; #39; libtool: compile: Try 'libtool -- help & amp; #39; formoreecompile pcre make pcre error solve compile pcre make

Solution E: EncounteredasectionwithnoPackage: header error: the following error occurs on my ubuntu machine. Readingpackagelists... Error! E: EncounteredasectionwithnoPackage: headerE: Proble... Solution E: Encountered a section with no Package:

Linux General automatic log cleanup script 1. this article is a simplified script for automatic system deployment. The main function is to clear logs from all directories. based on the given log directory, the deletion time is combined with crontab

The fdisk-l command in Linux describes some values of fdisk-l; Disk/dev/hda: 80.0 GB, 80026361856bytes255heads, 63 sectors/track, 9729cylindersUnitscylindersof16065*5128225280... linux fdisk-l command description of some fdisk-l values; Disk/dev/hda:

Other machines cannot access linuxtomcat. after the Tomcat server is configured on RedHat5.5, only the RedHat server can access the web services provided by Tomcat. other machines in the Lan cannot access the web services provided by Tomcat,

Check whether vsftprpm-qvsftpdpackagevsftpdisnotinstalled is installed in the system. if vsftpd is not installed in the system, the following error occurs when a virtual user data file is generated: users. db-bash: db_load: commandnotfound because

An example of suse kernel BUG: update_group_power: cpu_power introduction: Recently, five business servers have been down for three days. The reason is that the suse11sp1 kernel bug. System error message: system messages log error: Jun1014: 00:

Install Erlang development environment on CentOS 1. yumgroupinstallBase & quot; DevelopmentTools & quot; PerlSupport & quot; 2. yuminstallgccglibc-develmakencurses-developens Install Erlang Development environment on CentOS install Erlang

Basic file permissions in Linux every file in Linux is associated with multiple permission types. Among these permissions, we mainly deal with three types of permissions: user, user group, and other users (others ). A user is the object owner. a

How to modify the IP address in ubuntu IP address notes: sudovim/etc/network/interfaces, autoeth0ifaceeth0inetstaticaddressip address netmask subnet mask gateway broadcast address dns-nameserversDNS remember to heavy... how to modify the IP address

CentOS & mdash; this short article describes how to deploy the server after getting the root account and password of the server, configuring the NIC, FTP, and installing the server. This article is suitable for Linux beginners. Step * modify the

Shell O & M automation if-read in today's course, we will learn to judge user output parameters. Example: If you speak ill of others? That's the case. Story 2: When you eat snacks, when the cat calls you, you hear it, and then you divide the snacks

In the 1990s s when Linux and DOS coexist in their own base scripts, Linux Shell had one of the most insignificant but practical little functions, namely automatic completion of commands. However, the dummies of DOS have never learned how to use

Ubuntuapachefastcgi virtual host installation 1cp/etc/apache2/sites-available/default/etc/apache2/sites-available/www.domain.com here www.domain.com is the virtual host configuration file (of course, the file name can be) 2. Edit this configuration..